PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G22310.1
Common NameLOC102705552
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 341aa    MW: 36232.8 Da    PI: 4.3663
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G22310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.3e-2081134356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  OB08G22310.1  81 KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 134
                   56789************************************************9 PP

2HD-ZIP_I/II131.92.4e-4280171192
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   ekkrrl++eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+d+++Lk+aydal+++++ L +++++Lr+++ 
  OB08G22310.1  80 EKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHQVLLSDNDRLRAQVI 171
                   69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.23676136IPR001356Homeobox domain
SuperFamilySSF466894.18E-1976138IPR009057Homeodomain-like
SMARTSM003891.9E-1979140IPR001356Homeobox domain
CDDcd000862.47E-1881137No hitNo description
PfamPF000463.0E-1781134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-2182143IPR009057Homeodomain-like
PRINTSPR000316.3E-6107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000316.3E-6116132IPR000047Helix-turn-helix motif
PfamPF021836.4E-16136178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDPGRVVFDS GVARRGGGGA QMLLFGGGGS ANSGGFFRGV PTAVLGVEDA RGTAAVGKRP  60
FFTTHEELLE EEYYDEQAPE KKRRLTAEQV QMLERSFEEE NKLEPERKTE LARRLGMAPR  120
QVAVWFQNRR ARWKTKQLEH DFDRLKAAYD ALAADHQVLL SDNDRLRAQV ISLTEKLQDK  180
EMSPSSATIT TAAQEVDQPD EHTEAASATG CGGATVDDAL AAPLAAHQQQ LKDDLLSSGA  240
TTNDNDVGGG GVAAAVVFDV AEGSNDLSCE SAYFAAAAAS AYGRQYALSS EEEDGGAVSD  300
EGCSFGLPGD AAMFGATAGV VHHAAGDEEA QLGGWTAWIW S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457290.0AF145729.1 Oryza sativa homeodomain leucine zipper protein (Oshox5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659398.10.0PREDICTED: homeobox-leucine zipper protein HOX5-like
SwissprotQ6ZA741e-157HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
SwissprotQ9XH361e-157HOX5_ORYSI; Homeobox-leucine zipper protein HOX5
TrEMBLJ3MT010.0J3MT01_ORYBR; Uncharacterized protein
STRINGOB08G22310.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-51homeobox 1